PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr014064.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 519aa    MW: 56719.4 Da    PI: 5.5273
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr014064.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS396.72.4e-12120049279374
         GRAS  79 aalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                    +++f+e++P+lkf+h+taNqaIlea++g+++vH+iDf++++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g rLa++A++++v+f
  Pbr014064.1 200 LLYHYFYEACPYLKFAHFTANQAILEAFHGHDCVHVIDFNLMHGLQWPALIQALALRPGGPPLLRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRF 297
                  46789********************************************************************************************* PP

         GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                   f+ ++a+rled+++++L+v+p+Ea+aVn+++qlhrll ++ + +s+++ +L+ +++l+Pk+v+vveqeadhn++ Fl+rf+eal+yys++fdslea 
  Pbr014064.1 298 AFRGVAASRLEDVKPWMLQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLSWIRNLNPKIVTVVEQEADHNKPGFLDRFTEALYYYSTMFDSLEAC 395
                  ***********************************************************************************************999 PP

         GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                     + + ++++ +++++rei+nvv+cega+r+erhe l+kWr rl++aGF+p++l+++a kqa++ll  ++ +gyrvee++g+l+lgW++ pL+++Sa
  Pbr014064.1 396 ---AMQPEKTLAEMYIQREICNVVCCEGAARVERHEPLSKWRTRLGQAGFSPLHLGSNAFKQASMLLTLFSAEGYRVEENQGCLTLGWHSCPLIAASA 490
                  ...468888899999*********************************************************************************** PP

         GRAS 373 Wr 374
                  W+
  Pbr014064.1 491 WQ 492
                  *6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.8E-303298IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011297.5E-1932104No hitNo description
PROSITE profilePS5098555.613108472IPR005202Transcription factor GRAS
PfamPF035148.2E-119200492IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MGPYGSTTCS GVSSSASSSS SSSVTKSPAE IDGYLADAGY KVRASDLRHV AQRLEHLETV  60
MVNSPSDLSQ LASDAVLYNP SDIATWVDSL LSEFNPQPLI SLPSDLDFPD GAVINNPAAL  120
AGETWTDNSS VISAVPQQNH QLTVVTAMEE DSGIRLVHLL VTCAESVQRG ELTLAGSLIE  180
TMQALMTRVN TSCGIGKNEL LYHYFYEACP YLKFAHFTAN QAILEAFHGH DCVHVIDFNL  240
MHGLQWPALI QALALRPGGP PLLRLTGIGP PSPDGRDSLR EIGLRLAELA RSVNVRFAFR  300
GVAASRLEDV KPWMLQVSPK EAVAVNSIMQ LHRLLGSDPN RNSPIEMMLS WIRNLNPKIV  360
TVVEQEADHN KPGFLDRFTE ALYYYSTMFD SLEACAMQPE KTLAEMYIQR EICNVVCCEG  420
AARVERHEPL SKWRTRLGQA GFSPLHLGSN AFKQASMLLT LFSAEGYRVE ENQGCLTLGW  480
HSCPLIAASA WQVMSMAEAT TNHQPVGILN QNNNANHV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-5220049278375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0078880.0DQ007888.1 Malus x domestica DELLA protein (L3b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009371410.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ8S4W71e-160GAI1_VITVI; DELLA protein GAI1
SwissprotQ9LQT81e-160GAI_ARATH; DELLA protein GAI
TrEMBLQ0HA680.0Q0HA68_MALDO; DELLA protein
STRINGVIT_11s0016g04630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-141GRAS family protein